SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for C9J7S4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  C9J7S4
Domain Number 1 Region: 89-127
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 0.0000327
Family DBL homology domain (DH-domain) 0.0062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) C9J7S4
Sequence length 127
Comment (tr|C9J7S4|C9J7S4_HUMAN) Pleckstrin homology domain-containing family G member 2 {ECO:0000313|Ensembl:ENSP00000397615} KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=PLEKHG2 OC=Catarrhini; Hominidae; Homo.
Sequence
MPEGAQGLSLSKPSPSLGCGRRGEVCDCGTVCETRTAAPAAPTMASPRGSGSSTSLSTVG
SEGDPAPGPTPACSASRPEPLPGPPIRLHLSPVGIPGSARPSRLERVAREIVETERAYVR
DLRSIVE
Download sequence
Identical sequences C9J7S4
ENSP00000397615 ENSP00000397615

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]