SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for C9J8Q5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  C9J8Q5
Domain Number 1 Region: 57-505
Classification Level Classification E-value
Superfamily ALDH-like 2.23e-150
Family ALDH-like 0.000000182
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) C9J8Q5
Sequence length 507
Comment (tr|C9J8Q5|C9J8Q5_HUMAN) Succinate-semialdehyde dehydrogenase, mitochondrial {ECO:0000313|Ensembl:ENSP00000417687} KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=ALDH5A1 OC=Catarrhini; Hominidae; Homo.
Sequence
MATCIWLRSCGARRLGSTFPGCRLRPRAGGLVPASGPAPGPAQLRCYAGRLAGLSAALLR
TDSFVGGRWLPAAATFPVQDPASGAALGMVADCGVREARAAVRAAYEAFCRWREVSAKGK
PLKEAHGEILYSAFFLEWFSEEARRVYGDIIHTPAKDRRALVLKQPIGVAAVITPWNFPS
AMITRKVGAALAAGCTVVVKPAEDTPFSALALAELASQAGIPSGVYNVIPCSRKNAKEVG
EAICTDPLVSKISFTGSTTTGKILLHHAANSVKRVSMELGGLAPFIVFDSANVDQAVAGA
MASKFRNTGQTCVCSNQFLVQRGIHDAFVKAFAEAMKKNLRVGNGFEEGTTQGPLINEKA
VEKVEKQVNDAVSKGATVVTGGKRHQLGKNFFEPTLLCNVTQDMLCTHEETFGPLAPVIK
FDTEEEAIAIANAADVGLAGYFYSQDPAQIWRVAEQLEVGMVGVNEGLISSVECPFGGVK
QSGLGREGSKYGIDEYLELKYVCYGGL
Download sequence
Identical sequences C9J8Q5
ENSP00000417687 ENSP00000417687

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]