SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for C9JJY0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  C9JJY0
Domain Number 1 Region: 5-47
Classification Level Classification E-value
Superfamily Transcription factor IIA (TFIIA), alpha-helical domain 0.0000000000000314
Family Transcription factor IIA (TFIIA), alpha-helical domain 0.00056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) C9JJY0
Sequence length 335
Comment (tr|C9JJY0|C9JJY0_HUMAN) TFIIA-alpha and beta-like factor {ECO:0000313|Ensembl:ENSP00000396702} KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=GTF2A1L OC=Catarrhini; Hominidae; Homo.
Sequence
MACLNPVPKLYRSVIEDVIEGVRNLFAEEGIEEQVLKDLKQLWETKVLQSKATEDFFRNS
IQSPLFTLQLPHSLHQTLQSSTGWIPLVNEYSSLVIPAGRTLPSFTTAELGTSNSSANFT
FPGYPIHVPAGVTLQTVSGHLYKVNVPIMVTETSGRAGILQHPIQQVFQQLGQPSVIQTS
VPQLNPWSLQATTEKSQRIETVLQQPAILPSGPVDRKHLENATSDILVSPGNEHKIVPEA
LLCHQESSHYISLPGVVFSPQVSQTNSNVESVLSGSASMAQNLHDESLSTSPHGALHQHV
TDIQLHILKNRMYGCDSVKQPRNIEEPSNIPVSEK
Download sequence
Identical sequences C9JJY0
ENSP00000396702 ENSP00000396702

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]