SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for C9JUG1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  C9JUG1
Domain Number 1 Region: 17-163
Classification Level Classification E-value
Superfamily CBS-domain pair 1.64e-39
Family CBS-domain pair 0.000000214
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) C9JUG1
Sequence length 163
Comment (tr|C9JUG1|C9JUG1_HUMAN) 5'-AMP-activated protein kinase subunit gamma-2 {ECO:0000313|Ensembl:ENSP00000419493} KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=PRKAG2 OC=Catarrhini; Hominidae; Homo.
Sequence
MLEKLEFEDEAVEDSESGVYMRFMRSHKCYDIVPTSSKLVVFDTTLQVKKAFFALVANGV
RAAPLWESKKQSFVGMLTITDFINILHRYYKSPMVQIYELEEHKIETWRELYLQETFKPL
VNISPDASLFDAVYSLIKNKIHRLPVIDPISGNALYILTHKRI
Download sequence
Identical sequences A0A2J8JZK2 A0A2J8RKH8 C9JUG1
ENSP00000419493 ENSP00000419493

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]