SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for C9LTE4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  C9LTE4
Domain Number 1 Region: 84-177
Classification Level Classification E-value
Superfamily Ribosomal protein L6 4.64e-35
Family Ribosomal protein L6 0.0000407
Further Details:      
 
Domain Number 2 Region: 1-83
Classification Level Classification E-value
Superfamily Ribosomal protein L6 4.08e-27
Family Ribosomal protein L6 0.0000465
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) C9LTE4
Sequence length 183
Comment (tr|C9LTE4|C9LTE4_SELS3) 50S ribosomal protein L6 {ECO:0000256|HAMAP-Rule:MF_01365, ECO:0000256|RuleBase:RU003870} KW=Complete proteome; Reference proteome OX=546271 OS=Selenomonas sputigena (strain ATCC 35185 / DSM 20758 / VPI D19B-28). GN=Selsp_1475 OC=Selenomonadaceae; Selenomonas.
Sequence
MSRIGRAPIEIPAGVTVKIEEVNKVTVKGPKGELFRELHPDMKIAVEGNVLTVTRPSDDK
EHRSLHGLTRTLINNMVVGVTEGFKKTLEINGVGYRAAKQGKNLNLSLGFSHPVIVEPPA
GITLDAPSATSIVVSGIDKEAVGAIAAKIRSYRLPEPYKGKGIKYEGEHIRRKVGKAGAK
AKK
Download sequence
Identical sequences C9LTE4
gi|330839311|ref|YP_004413891.1| WP_006191748.1.43677 WP_006191748.1.73955

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]