SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for C9LY26 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  C9LY26
Domain Number 1 Region: 164-564
Classification Level Classification E-value
Superfamily Phase 1 flagellin 0.0000000000000011
Family Phase 1 flagellin 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) C9LY26
Sequence length 571
Comment (tr|C9LY26|C9LY26_SELS3) Flagellar hook-associated protein 1 {ECO:0000256|RuleBase:RU362065} KW=Complete proteome; Reference proteome OX=546271 OS=Selenomonas sputigena (strain ATCC 35185 / DSM 20758 / VPI D19B-28). GN=Selsp_0320 OC=Selenomonadaceae; Selenomonas.
Sequence
MVRGIYNNQLSLDTVGHNITNANTEGYSRQRVNPAATRPLEQGGMFGGLFVGTGVDSESL
TRARDFFADKQYWQEEATESYAKYRQKNYDKIEAVFNDSKTKGLQNAMHKFYSAWNDLSV
YASDPAKRVSVVESGKQFADRLEESAQNVQKQLDLVYREMDTQVKDVNEITQKIVELNKN
ISLAEANGAMANDLRDKRDLLVDKLSGYMSLHVYEMDNGMYQIVSGGASIVNGISRLELK
MDGPVENKRYGVNDYSLIFKDTNTLFVPGNGTLQAAVDSIKEDKAYMDKLANIAATFMTQ
FNDQHRAGAGIDKDKTSNLNFFGRNDKYYVWDKERQSLLAAKVTGTGSTTAGSPPVTTHT
TTLSTTPGDTEELQGLEIIKAMKVSAELVTQNGELKVAARGFGDNSDAKNSYVQNFSYSN
STVPPNITGTGTVVHTTSDMNGTADGSNAVLLTNIFNMEQKDTGLTIYKNPTAGSPTETR
PTGTVSLNNYYNSVTSALGIDSNAMDTKVKFQQDVMTQIEAWRTSVSGVNWNEELSNMIK
FQQGYSACARCMTTMDEMLDRLVNNTGLVGR
Download sequence
Identical sequences C9LY26
gi|330838173|ref|YP_004412753.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]