SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for D0A4Q0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D0A4Q0
Domain Number 1 Region: 250-513,542-562
Classification Level Classification E-value
Superfamily Cryptochrome/photolyase FAD-binding domain 2.49e-80
Family Cryptochrome/photolyase FAD-binding domain 0.00000242
Further Details:      
 
Domain Number 2 Region: 23-204
Classification Level Classification E-value
Superfamily Cryptochrome/photolyase, N-terminal domain 8.24e-33
Family Cryptochrome/photolyase, N-terminal domain 0.00045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) D0A4Q0
Sequence length 568
Comment (tr|D0A4Q0|D0A4Q0_TRYB9) Deoxyribodipyrimidine photolyase, putative {ECO:0000313|EMBL:CBH16244.1} KW=Complete proteome OX=679716 OS=Trypanosoma brucei gambiense (strain MHOM/CI/86/DAL972). GN=TbgDal_X13410 OC=Eukaryota; Euglenozoa; Kinetoplastida; Trypanosomatidae; Trypanosoma.
Sequence
MYVPSRVVAVKRQRTPSQPLPAAVFIFRRDFRVTDNTGLLLLIERAGKQSLPVIPLFFFN
PRQCDPDKNPYFGKACFEFLCQSLKHLDTVQLGGRLVCLRGSDCDCLEVVRSSGYDIKQL
GFNRDITPFARKRDLQLEEWCVKRGVRCVTSNMDYTLLPPDVVTNKNGKPYRVFSPFYRA
VLQEHFSDIQAPNPKATTIGDIFTGSHVKEDVKATVDQARRSAMAADEFSSLVDYVDLAA
LPQTFPELVDRGGRSEGLLRLASVASAKNYSAIRDDIPGDKTTHLSPHLKFGTISIREAM
QVALLHLGKEHAFTRQLIWREFYSMLLYHNPRLALGQLKMDVALQGERQCRATLANEPFL
EKYSNFQWEWNDAEFTAFKSGATGFPLVDAAVRCLTKTGWCHNRCRMLIANFLVKVLFVD
WREGERWYATVAVDYDVANNSGGWLWSSGQGADAQPYFRFFNPFRQSAQHDPQAVFIKQW
VPELRNVSVRTIHKWDVFCKEGRPADEGTLGTVQGTVKESNGIKKEKTELPLGGSIVGGS
AYPSPIVDLKQRTKWIVERYKKHAAEVI
Download sequence
Identical sequences D0A4Q0
XP_011778508.1.14543 Tbg972.10.13410

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]