SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for D0KMS9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D0KMS9
Domain Number 1 Region: 23-265
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 5.74e-34
Family Extended AAA-ATPase domain 0.00093
Further Details:      
 
Domain Number 2 Region: 284-378
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 1.63e-20
Family Helicase DNA-binding domain 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) D0KMS9
Sequence length 394
Comment (tr|D0KMS9|D0KMS9_SULS9) ORC1-type DNA replication protein {ECO:0000256|HAMAP-Rule:MF_01407} KW=Complete proteome OX=555311 OS=Sulfolobus solfataricus (strain 98/2). GN=Ssol_0003 OC=Sulfolobus.
Sequence
MHVIRETLKGGKGEVIKNPKVFIDPLSVFKEIPFREDILRDAAIAIRYFVKNEVKFSNLF
LGLTGTGKTFVSKYIFNEIEEVKKEDEEYKDVKQAYVNCREVGGTPQAVLSSLAGKLTGF
SVPKHGINLGEYIDKIKNGTRNIRAIIYLDEVDTLVKRRGGDIVLYQLLRSDANISVIMI
SNDINVRDYMEPRVLSSLGPSVIFKPYDAEQLKFILSKYAEYGLIKGTYDDEILSYIAAI
SAKEHGDARKAVNLLFRAAQLASGGGIIRKEHVDKAIVDYEQERLIEAVKALPFHYKLAL
RSLIESEDVMSAHKMYTDLCNKFKQKPLSYRRFSDIISELDMFGIVKIRIINRGRAGGVK
KYALVEDKEKVLRALNETFEDSISIGDFDDVGEN
Download sequence
Identical sequences A0A0E3JSK6 D0KMS9 Q97WM8
gi|15898963|ref|NP_343568.1| 273057.SSO2184 gi|384432552|ref|YP_005641910.1| WP_009992115.1.14611 WP_009992115.1.22626 WP_009992115.1.43719 WP_009992115.1.57434 WP_009992115.1.66040 WP_009992115.1.8449 WP_009992115.1.93834

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]