SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for D0KP82 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D0KP82
Domain Number 1 Region: 174-272
Classification Level Classification E-value
Superfamily Multidrug resistance efflux transporter EmrE 0.000000000379
Family Multidrug resistance efflux transporter EmrE 0.011
Further Details:      
 
Weak hits

Sequence:  D0KP82
Domain Number - Region: 61-129
Classification Level Classification E-value
Superfamily Multidrug resistance efflux transporter EmrE 0.0157
Family Multidrug resistance efflux transporter EmrE 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) D0KP82
Sequence length 274
Comment (tr|D0KP82|D0KP82_SULS9) Uncharacterized protein {ECO:0000313|EMBL:ACX92769.1} KW=Complete proteome OX=555311 OS=Sulfolobus solfataricus (strain 98/2). GN=Ssol_2674 OC=Sulfolobus.
Sequence
MQRTTISFLRWIVPLSLFWGFAFPLTKIIAYSASPMIISAFRIGIAAIFFLILGRGLSVG
KKQFINGLMNFAFFLILINLGIGLSPDPGLVAVMIYTQPIFVLIIERLLGHKITPKGIVG
VLLGVVGVISSATLSFNIGLVFGLLAGILWAGGTIYYSRNLAKEDIVKLNAFMTLTSLPI
VLAFTPIDYYFRFSLVTLSLLLLLAILAQILGFYFWFNGVRELGTVYASTGSLLVPVMAY
ITSFAVLGVAPTLPQIIGSLITLFGVYLTITSRS
Download sequence
Identical sequences A0A0E3KDM5 D0KP82 Q97X73
gi|384435012|ref|YP_005644370.1| GO.4287 WP_009991420.1.14611 WP_009991420.1.22626 WP_009991420.1.43719 WP_009991420.1.57434 WP_009991420.1.66040 WP_009991420.1.8449 WP_009991420.1.93834 273057.SSO1880 gi|15898674|ref|NP_343279.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]