SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for D0KQB9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D0KQB9
Domain Number 1 Region: 6-126
Classification Level Classification E-value
Superfamily Homeodomain-like 0.00000000000136
Family Cgl2762-like 0.045
Further Details:      
 
Domain Number 2 Region: 192-304
Classification Level Classification E-value
Superfamily Ribonuclease H-like 0.00000000000316
Family Retroviral integrase, catalytic domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) D0KQB9
Sequence length 327
Comment (tr|D0KQB9|D0KQB9_SULS9) Transposase-like protein {ECO:0000313|EMBL:ACX90984.1} KW=Complete proteome OX=555311 OS=Sulfolobus solfataricus (strain 98/2). GN=Ssol_0725 OC=Sulfolobus.
Sequence
MQDLVQAYKEEKNARIKERILAVKLHVVDGKSEKEVSKMLNKGYSTIKLWIGKYKKEGLD
GLKDKPRSGRPRKVEEEKIKQILEDKPQKYGIQQEYWTMKTLKIALQEQGIEYKKSRLYE
LVHELGYNLVKPRPTNIQAEKDKWEDFKKIKKLERKALFFLDECRTVISTSIKKVLAKVG
SKPVMRVNIGFSSIYVILAINAWTGEVVVSLAKRPNSESVKYFLRYFKRRVGSGRVYMVM
DNYSPHKTKGTLEVCRRKGIHPVFTPPYSPELNMAEAVFKSLKNYMSNKIFYTIEDVKNC
IKQFFEENKYRFNLNAITYLGLDKIEV
Download sequence
Identical sequences A0A0E3MEZ4 D0KQB9 Q97TV5
WP_010923242.1.14611 WP_010923242.1.22626 WP_010923242.1.43719 WP_010923242.1.66040 WP_010923242.1.8449 WP_010923242.1.93834 gi|384433227|ref|YP_005642585.1| gi|384434637|ref|YP_005643995.1| gi|15898053|ref|NP_342658.1| gi|15898087|ref|NP_342692.1| 273057.SSO1200 273057.SSO1238 353989 354060

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]