SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for D0S396 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D0S396
Domain Number 1 Region: 39-272
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 5.24e-64
Family Phosphate binding protein-like 0.0000755
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) D0S396
Sequence length 277
Comment (tr|D0S396|D0S396_ACICA) NLPA lipoprotein {ECO:0000313|EMBL:EEY77913.1} KW=Complete proteome OX=575585 OS=Acinetobacter calcoaceticus RUH2202. GN=HMPREF0012_00782 OC=Acinetobacter calcoaceticus/baumannii complex.
Sequence
MAIQFKQYKPWLLGITILIVILGLVGYRYIKNKQTDDVLTIGISPPYAELLQSVANEVEK
QGVHVKLVEFSDWRAPNVAVQNGDIDANFFQQSVFLRNAVKETGYDLHAFAVGSGSHVGL
YSKKYKTLDDLPSQARVAIPNDPVNLARALILLHRAGLIQLKDSNNELSTTQDIIANPKQ
LSFVEVEGPQTAHAYNDVDLIFGFPHYLKMAKVTDPHSALFLDPIDKKYAILFVTRRDYQ
DKNQKLATFVKAFQNSKQAQDILDKDFGQGMWFQGWK
Download sequence
Identical sequences D0S396
WP_003651333.1.78621 HMPREF0012_00782T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]