SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for D0SHB6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D0SHB6
Domain Number 1 Region: 14-403
Classification Level Classification E-value
Superfamily DmpA/ArgJ-like 8.37e-137
Family ArgJ-like 0.00000247
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) D0SHB6
Sequence length 406
Comment (tr|D0SHB6|D0SHB6_ACIJO) Arginine biosynthesis bifunctional protein ArgJ beta chain {ECO:0000256|HAMAP-Rule:MF_01106} KW=Complete proteome OX=575586 OS=Acinetobacter johnsonii SH046. GN=HMPREF0016_03239 OC=Moraxellaceae; Acinetobacter.
Sequence
MPVGDVSMPQMHVVKGVRIGTAEAYVRYQNRRDLVIFEFAEGTNVAGVFTQNAFCAAPVH
VSKAHLHVANPRYLIINTGNANAGTGKTGMLNAERTCAKLAELARVQATEVLPFSTGVIG
EQLPLERLLNGLQPALNSLSADAWDAAATGIMTTDTTPKGASEQFELDGITYTMTGISKG
AGMIRPNMATMLGYVATDAPISRELVQQLLSETVNVSFNRITIDGDTSTNDSCIFAATGQ
AGGVEICSTQDARYTVVLDVLTRMMKRLAQLIVRDGEGATKFITVAVEGGHDTQECCDIA
YSIAHSPLVKTAIFASDPNWGRILAAIGYAGVKNLDVEKIQVWLDDVQICKDGGAAADYT
EAEGARVMSQAEMTIRVDLGRGAAKDTVYTCDLSYDYVKINADYRS
Download sequence
Identical sequences D0SHB6
HMPREF0016_03239T0 WP_005401949.1.2557

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]