SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for D1ADG1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D1ADG1
Domain Number 1 Region: 1-254
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 8.5e-73
Family Protein kinases, catalytic subunit 0.000000054
Further Details:      
 
Domain Number 2 Region: 507-569
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0000235
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.012
Further Details:      
 
Domain Number 3 Region: 441-502
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0000419
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.017
Further Details:      
 
Weak hits

Sequence:  D1ADG1
Domain Number - Region: 370-431
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.000798
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) D1ADG1
Sequence length 594
Comment (tr|D1ADG1|D1ADG1_THECD) Serine/threonine protein kinase with PASTA sensor(S) {ECO:0000313|EMBL:ACY95671.1} KW=Complete proteome; Reference proteome OX=471852 OS=NBRC 15933 / NCIMB 10081 / Henssen B9). GN=Tcur_0063 OC=Thermomonospora.
Sequence
MAEVYRAKDLRLDRVVAVKTLRSDLARDPVFQARFSREAQSAASLNHPSVIAVYDTGEDQ
VGDTSIPYIVMEYVEGNTLRDLLREGGRLVPERALEITDGILRALDYSHRGGIIHRDIKP
ANVMLTRNHEVKVMDFGIARAMADSAATMTQTAQVIGTAQYLSPEQARGERVDARSDLYS
TGCVLYELLTGRPPFTGDSPVAIAYQHVREEPVPPSQLDPAIPQWCDNIVMKAMAKDPNL
RYQSAAEFRADIQRALQGMPVSAPAASTMVMGGAAPQGTRVMSPVPGGPAGPGGVPPHTR
MQHPVNTGYELPPVNYEDPEPSGRNGKKIAIWALVVALFIGGAALIGYALSSGGGKGGAT
ASPSASVQMVEVPDVRNERRQDAEEELEEAGLKVGSVEEEYSDTVRRGRVISTDPAPGES
VERGSEVSLVVSKGPEPPEQVAVPDVTGQPADAARQVLEASGFKVTQRSSPSSEVQEGMV
IQTSPAAGTQAPKGSTITMIVSSGPENVRVPNVVGQTEADAVNTLRAAGLRVQVQVVPQR
SPDQQVGTVVQQSLEPGREVLPGTTVIILVVQNPDGGDPGDDHGPPGGGGGGGG
Download sequence
Identical sequences D1ADG1
gi|269124339|ref|YP_003297709.1| 471852.Tcur_0063

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]