SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for D1AGH6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D1AGH6
Domain Number 1 Region: 204-396
Classification Level Classification E-value
Superfamily PheT/TilS domain 5.75e-71
Family B3/B4 domain of PheRS, PheT 0.0000117
Further Details:      
 
Domain Number 2 Region: 37-193
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 5.14e-48
Family Myf domain 0.0028
Further Details:      
 
Domain Number 3 Region: 469-693
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 3.33e-41
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.00047
Further Details:      
 
Domain Number 4 Region: 701-798
Classification Level Classification E-value
Superfamily Anticodon-binding domain of PheRS 4.71e-27
Family Anticodon-binding domain of PheRS 0.00076
Further Details:      
 
Domain Number 5 Region: 406-477
Classification Level Classification E-value
Superfamily Putative DNA-binding domain 0.00000000000000101
Family Domains B1 and B5 of PheRS-beta, PheT 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) D1AGH6
Sequence length 799
Comment (tr|D1AGH6|D1AGH6_SEBTE) Phenylalanyl-tRNA synthetase beta subunit {ECO:0000256|HAMAP-Rule:MF_00283} KW=Complete proteome; Reference proteome OX=526218 OS=Sebaldella termitidis (strain ATCC 33386 / NCTC 11300). GN=Sterm_4096 OC=Bacteria; Fusobacteria; Fusobacteriales; Leptotrichiaceae; Sebaldella.
Sequence
MLISLNWLKQYIDLEGISIEELDNTLTMIGQEVEKIERQGESLGNIVTAQIVEKEMHPDS
DHLTVCKVDDGNEVLQIVCGASNHKQGDKVVLARIGAVLGGDFKIKKTKIRGMESFGMLC
SEKELGLSDNHDGIMILPEDTKTGIEIKDYFGLDDTIFELEITPNRPDCLSHIGIARELA
VYYNKELHLPETKMHEKHFEKTENFIHIEIADETISKRYTSKIVKNVTVKESPEWLQKRL
NSIGIRSINNIVDVTNFVLMEMGHPIHAFDLSKIEGKKIIVRRAEDGEKVVTLDEKERKL
NPDDIVIADGNKAVALGGVMGGYNSEIDSNTKDVLIEVAHFNPYNIRKTSKRLTLSSDAS
YRFERGIDLEDAVRVIDRVAELIQETAGGEILHGISEAYPVKYEETIVEFNMKRFEKFVG
KEIEKERIIEIFENLEITVDDKGEVLLLTPPSFRNDLEREQDFYEEIIRIYGFDNIESVM
PKLDINPIRIDTLREIDLLRSAAVAVGTGLREVINYSFIPRNALEKIRYNDAAGDEIIEV
RKPITEDFVIMRPTLLYSLIKNAKDNINRNITDIRFFETTKTFKRVEGKIEEEQKFGIIL
GGEPEKYIWNVKPVPYDFYDLKGIVEEIFSKIRFEKYTLVRTTKESYHPGRAADIYVGKE
YIGTFGELHPDVMENFDLKKKLLTAELRLEALIKYSDKNIFFKGINKFPAVPRDLALVIE
ENILVGDVIKSIAKLSPVIEKVELFDVYQGAGVEAGKKSIAISIVLREKNKTLEENEINS
VISKILEKVKKDFGAELRQ
Download sequence
Identical sequences D1AGH6
WP_012863503.1.35130 gi|269122682|ref|YP_003310859.1| 526218.Sterm_4096

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]