SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for D1AGP9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D1AGP9
Domain Number 1 Region: 1-280
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 1.37e-129
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.00000000691
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) D1AGP9
Sequence length 289
Comment (tr|D1AGP9|D1AGP9_SEBTE) Glycyl-tRNA synthetase alpha subunit {ECO:0000256|HAMAP-Rule:MF_00254} KW=Complete proteome; Reference proteome OX=526218 OS=Sebaldella termitidis (strain ATCC 33386 / NCTC 11300). GN=Sterm_3936 OC=Bacteria; Fusobacteria; Fusobacteriales; Leptotrichiaceae; Sebaldella.
Sequence
MTFQNIILTLQKFWGDKGCVIGNPYDVETGAGTFNPDTFLMSLGPEPWNIAYVEPSRRPK
DGRYGENPNRLYQHHQFQVIMKPSPENIQELYLESLSALGIDPKEHDIRFVEDNWESPTL
GAWGLGWEVWLDGMEVTQFTYFQQVGGIELDITPVELTYGLERLALYLQNKDNVYDLEWT
EGVRYGERRYQYEYEMSKYSFEVSDSDMNFKLFDMYEKEAKNCLDHNLVLPGYDYVLKCS
HVFNNLDARGSISTTERMSYILRVRDLAKICAEQFVEVRKKLGFPLLKK
Download sequence
Identical sequences D1AGP9
526218.Sterm_3936 gi|269122523|ref|YP_003310700.1| WP_012863344.1.35130

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]