SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for D1AJJ8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D1AJJ8
Domain Number 1 Region: 116-419
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 1.52e-101
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.000000582
Further Details:      
 
Domain Number 2 Region: 1-112
Classification Level Classification E-value
Superfamily tRNA-binding arm 3.09e-28
Family Seryl-tRNA synthetase (SerRS) 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) D1AJJ8
Sequence length 423
Comment (tr|D1AJJ8|D1AJJ8_SEBTE) Seryl-tRNA(Ser/Sec) synthetase {ECO:0000256|HAMAP-Rule:MF_00176} KW=Complete proteome; Reference proteome OX=526218 OS=Sebaldella termitidis (strain ATCC 33386 / NCTC 11300). GN=Sterm_2031 OC=Bacteria; Fusobacteria; Fusobacteriales; Leptotrichiaceae; Sebaldella.
Sequence
MIDMKFIRENTEIIRKSLKDRNSNFDLDGLLKADEARRELLQEAETLKKEKNDQSALIGK
YKREGKNADELLEKMGKVSDKIKELDEKTAKIEEEQNYLLLTIPNKLHESTPVGASEDDN
VEVRKWGEPKKFGFEPKPHEELGTELGILDFERGVKLSGSRFTVYKGMAAKLERALINFM
LDLHTSEHGYEEMLTPQLVKRDIMVGTGQLPKFEDDAYKTTDDMFLIPTAEVTLTNLHKD
EILAESELPKYYCGFTACFRREAGSHGKDMKGILRQHQFNKVEMVKIVHPENSYDELEKM
VNNAETVLQKLNIPYRVLALCSGDIGFGASKTYDLEVWIPSQNKYREISSCSNTEDFQAR
RAMIKYRSETDKKSYFVHTLNGSGLAVGRTLLAIMENYQKEDGSIEIPEVLIPYMGGITE
IKK
Download sequence
Identical sequences D1AJJ8
WP_012861480.1.35130 526218.Sterm_2031 gi|269120640|ref|YP_003308817.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]