SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for D1AKB1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D1AKB1
Domain Number 1 Region: 13-305
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 1.35e-38
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.0000846
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) D1AKB1
Sequence length 375
Comment (tr|D1AKB1|D1AKB1_SEBTE) tRNA synthetase class II (G H P and S) {ECO:0000313|EMBL:ACZ09027.1} KW=Complete proteome; Reference proteome OX=526218 OS=Sebaldella termitidis (strain ATCC 33386 / NCTC 11300). GN=Sterm_2173 OC=Bacteria; Fusobacteria; Fusobacteriales; Leptotrichiaceae; Sebaldella.
Sequence
MKKFISSLKEEEKIILKLRKHYEQYGYKKIKLSKFESYDLYNENADFIKIENIITFMAPT
GKLQTLRPDVTLSIVKKYARDKKKEMEKLYYIENIYRLSKEDMEYKELNQIGVEILGESD
GYSDFEIINLAAESMELINKNFILDISNINYLSGLFEEMNLGYTLEEEVLMNIQHKNVHD
LEKILTKENVESKYKEILIKIPDLSGKFHNVITEAEKLVLNEKMQKALDELKMLGQAFPK
MIKNGKILLDFSIVNSLDYYNGLIFHGYIENNPKIILSGGNYDKLIEKYDKNKGATGFAI
YLDELSGKYKIEKEYDFDILILYKNGDNAKLLNIVKKYIDQGLTIRTEKYREDFNTNFKY
KEKYIFEDDRLVGKE
Download sequence
Identical sequences D1AKB1
WP_012861621.1.35130 gi|269120781|ref|YP_003308958.1| 526218.Sterm_2173

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]