SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for D1ARW6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D1ARW6
Domain Number 1 Region: 1-242
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 7.81e-79
Family LplA-like 0.000000303
Further Details:      
 
Domain Number 2 Region: 243-328
Classification Level Classification E-value
Superfamily SufE/NifU 1.67e-20
Family SP1160 C-terminal domain-like 0.00058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) D1ARW6
Sequence length 329
Comment (tr|D1ARW6|D1ARW6_SEBTE) Lipoate--protein ligase {ECO:0000256|SAAS:SAAS00603724} KW=Complete proteome; Reference proteome OX=526218 OS=Sebaldella termitidis (strain ATCC 33386 / NCTC 11300). GN=Sterm_3768 OC=Bacteria; Fusobacteria; Fusobacteriales; Leptotrichiaceae; Sebaldella.
Sequence
MKYIINENNNPRYNLALEEYVLKNLDGEYFFLWQNEPTIVIGKHQNTISEINLDYVEKKG
IHVVRRMSGGGAVYHDLGNINFSFIQEKKDLADFDFSFFTRPIVDLLGELGIKAEFNSRN
DLAIDGKKFSGNAQYIFKKKILHHGTLLFNSEMEELVNSLKVSKDKIESKGLKSIKSRVA
NIKDYIGEDSKIKEVSDFKVALFEHMKNRMEEFEEYVLTENDKKEIEKLKKEKYDKWEWN
YGESPEADIHRQRKYTAGKVESYIKLKDGLIENIKLYGDFFSSREIEDLESGLKGKKYMI
SEIAEYLKTVNVSEYFSGFSEEEILDVII
Download sequence
Identical sequences D1ARW6
526218.Sterm_3768 WP_012863184.1.35130 gi|269122356|ref|YP_003310533.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]