SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for D1AWE8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D1AWE8
Domain Number 1 Region: 49-227
Classification Level Classification E-value
Superfamily PheT/TilS domain 6.54e-34
Family B3/B4 domain of PheRS, PheT 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) D1AWE8
Sequence length 231
Comment (tr|D1AWE8|D1AWE8_STRM9) B3/4 domain protein {ECO:0000313|EMBL:ACZ00624.1} KW=Complete proteome; Reference proteome OX=519441 OS=NCTC 10651 / 9901). GN=Smon_0131 OC=Streptobacillus.
Sequence
MKFIAEESYWNLFPNSKLGIVLIEDMNNGGESSKEIKEALMASNEEAKKYFIKDNFSENP
VISVWREAYQKFKTKKGVRSSIEALLKRVEKGNEVSSINPLVDIYNTISLKYGMPCGAED
SDTFKGILRLGITEGNDEFYLIGEDKNSPTLQGELCYRDDEGAVCRCFNWRDGKRTMVTD
KTKNAFLIIELIDNEREKELNDALNEIAENIEKYLMAKTKIVILSKDNREI
Download sequence
Identical sequences D1AWE8
gi|269122924|ref|YP_003305501.1| 519441.Smon_0131

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]