SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for D1B4Q2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D1B4Q2
Domain Number 1 Region: 4-259
Classification Level Classification E-value
Superfamily Cytidine deaminase-like 2.44e-67
Family FdhD/NarQ 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) D1B4Q2
Sequence length 262
Comment (tr|D1B4Q2|D1B4Q2_SULD5) Sulfur carrier protein FdhD {ECO:0000256|HAMAP-Rule:MF_00187, ECO:0000256|SAAS:SAAS00771002} KW=Complete proteome; Reference proteome OX=525898 OS=Sulfurospirillum deleyianum (strain ATCC 51133 / DSM 6946 / 5175). GN=Sdel_2060 OC=Campylobacteraceae; Sulfurospirillum.
Sequence
MEPVFKTTITKIKGKEKFEREDTLVREIKLELIVNGNRVGAVMATPVDQEALAIGYLMSE
NIIEKLSDVTSLKLLNDGMRVEIEAKVNEESIHKLNAEGVVISGCGKSMTANIDPEAIAA
KVIQSPFKLSSRKLSTEMSQFYTECPLYEQTGCVHTAKLFTDEHTYFIGEDIAQHNTIDK
VVGKAVLAGADVKNAFLMVSGRLSSEMVAKAVMHQIPILASRTASTCLGLMIAEKFGLTL
IGFVRGDTMNIYRHPQRIVVEA
Download sequence
Identical sequences D1B4Q2
WP_012857817.1.51747 gi|268680676|ref|YP_003305107.1| 525898.Sdel_2060

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]