SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for D1B9L4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D1B9L4
Domain Number 1 Region: 290-512
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.08e-41
Family ABC transporter ATPase domain-like 0.00023
Further Details:      
 
Domain Number 2 Region: 23-280
Classification Level Classification E-value
Superfamily DNA repair protein MutS, domain III 0.00000000000000209
Family DNA repair protein MutS, domain III 0.017
Further Details:      
 
Domain Number 3 Region: 707-777
Classification Level Classification E-value
Superfamily SMR domain-like 0.0000000131
Family Smr domain 0.01
Further Details:      
 
Weak hits

Sequence:  D1B9L4
Domain Number - Region: 566-612
Classification Level Classification E-value
Superfamily F1F0 ATP synthase subunit B, membrane domain 0.00157
Family F1F0 ATP synthase subunit B, membrane domain 0.0085
Further Details:      
 
Domain Number - Region: 496-556
Classification Level Classification E-value
Superfamily Putative DNA-binding domain 0.0366
Family DNA-binding N-terminal domain of transcription activators 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) D1B9L4
Sequence length 780
Comment (tr|D1B9L4|D1B9L4_THEAS) Endonuclease MutS2 {ECO:0000256|HAMAP-Rule:MF_00092, ECO:0000256|SAAS:SAAS00250893} KW=Complete proteome; Reference proteome OX=525903 OS=Su883) (Selenomonas acidaminovorans). GN=Taci_0734 OC=Thermanaerovibrio.
Sequence
MRCDPNTYRVLEIEKALAIVAGRCRSELGVARAFRSSPARDVESLRRRFDLLRAYSSAVA
RRGDYPWDQRVTPMEGLVRDAKTYGWLNGQELVKVRNSLILSSRIKVRLKEDCSEFEALR
DLLRHFPDWEEELGRLEVLDEDGALYDGASTKLKELRFKGRELRSLARQRWNEILSNGSL
ASMLQDRVLTLRNGRFCALVRLDMAGSFPGLVVERSSSGNSVYVEPAPILPLNNRMAVIA
GEEREEEQRILRALTEMLLSREGALLETDRGLGYLDLLNAQVELLSESSWVVPEVSNDRS
FKLRSARHPLLGERAVPLDVSCGEHARMMVITGPNTGGKTVALKTVGVCVYLSWLGFPVP
CAEGTVVGNLGELLADIGDEQSIEQNLSTFSGHIKQLRYIMESAKDRSLVLLDELGAGTD
PEEGSALGVAILEFFLRRRCLLMATTHYNRIKLFAMTTPGVEAASMEFDSTTLQPTYRLL
VGIPGSSNAILIAERLKLPREVIQRAREEMETRSDGTEALLKGLEARRAELEERLREVEA
LRAHLQERERLYEEKYGRILSDSEGIIRETRAKAQGIIKRAEEEAKALLKELRDKSHAEA
QRTYQRDRDRLRKLGQAVEDLGRDVMEASPLPGPQSLSVGDPVEIRGSAVKGELAQVDGD
HGVVVSGPMRIRVPLKKLVRSSSPLPVPQSRVLVSSPEKVSSSIMVRGMTLDEAMPIVER
YLDQAYRAGYGEVEIIHGRGEGILRRAVHDLCRRLPFVESFRLGGPGEGGHGVTIVRFAR
Download sequence
Identical sequences D1B9L4
gi|269792345|ref|YP_003317249.1| 525903.Taci_0734 YP_003317249.1.71145

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]