SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for D1C3Q8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D1C3Q8
Domain Number 1 Region: 46-210
Classification Level Classification E-value
Superfamily ClpP/crotonase 2.43e-21
Family Biotin dependent carboxylase carboxyltransferase domain 0.094
Further Details:      
 
Domain Number 2 Region: 393-455
Classification Level Classification E-value
Superfamily NfeD domain-like 0.00000183
Family NfeD domain-like 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) D1C3Q8
Sequence length 474
Comment (tr|D1C3Q8|D1C3Q8_SPHTD) Uncharacterized protein {ECO:0000313|EMBL:ACZ38875.1} KW=Complete proteome; Reference proteome OX=479434 OS=Sphaerobacter thermophilus (strain DSM 20745 / S 6022). GN=Sthe_1440 OC=Sphaerobacterineae; Sphaerobacteraceae; Sphaerobacter.
Sequence
MRQQLRQQRRRVGNRPVQQLTLLGALLCFLVAALLASPAPARAAPNRVYGLTIDGVINQL
TADHVVRVLDEAEREHGAVLLVTIDSPGGVDSAIRRITQAFLAARIPVVVYVGPEPQAEA
LSGAMFITLAGHVAAMAPDAVIGAALPAGLAERASPEEREERMANALQVAATTAEARGRN
VQATVDAVRAEEILSADVAAADGIIDQVAPSVPLLLEQIDGLEVRTASGTVTLATREAPI
RWMTLTPRERVVQEITNPNVAYLLFSAGVLLLIVAVYASAHLLAGIPAIVALATAIIAFG
NLPTSWVGLGLLTAGALLFIVELYTPKVGLPGAAGVICYLIGSFTLYQPVRQESPFAPVV
RVNPWLAVGTVSFFVVALLLILRFLFRARRTALASTAAALIGRTGVVVRPLDPVGTVLVA
DQEWAATSPDAPLSEGSPVRVTGSEDGLLRVMPLPPDVAQSDSREGAHRGWRAP
Download sequence
Identical sequences D1C3Q8
gi|269837469|ref|YP_003319697.1| WP_012871922.1.32378 479434.Sthe_1440

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]