SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for D1CB69 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  D1CB69
Domain Number - Region: 39-131
Classification Level Classification E-value
Superfamily E set domains 0.0197
Family Filamin repeat (rod domain) 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) D1CB69
Sequence length 218
Comment (tr|D1CB69|D1CB69_THET1) Uncharacterized protein {ECO:0000313|EMBL:ACZ42034.1} KW=Complete proteome; Reference proteome OX=525904 OS=Thermobaculum terrenum (strain ATCC BAA-798 / YNP1). GN=Tter_1119 OC=Bacteria; Thermobaculum.
Sequence
MSRVMLTLRVFASILLIVLFMSGVAGAHEHRQVGKYELVVGFQNEPAYVGEPNGIWIQVT
EAKNQGDQSNNQESDEHEETGKPVKGLEKTLKAEVIQGNSRMQVPLSPAWNQPGVYVGNF
IPTVAGDYKFHFTGSINGQNIDETFESGPNRFSPVEDVTAIQFPIKTGSPEQISSELEQA
RSTANQSRILGVAGVVIGAIGLAVGLVALAGRRRYSKI
Download sequence
Identical sequences D1CB69
525904.Tter_1119 gi|269926233|ref|YP_003322856.1| WP_012875069.1.85100

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]