SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for D1CBT1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D1CBT1
Domain Number 1 Region: 315-593
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 8.35e-70
Family RecA protein-like (ATPase-domain) 0.0000000586
Further Details:      
 
Domain Number 2 Region: 277-334
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.00000343
Family Cold shock DNA-binding domain-like 0.00061
Further Details:      
 
Domain Number 3 Region: 229-272
Classification Level Classification E-value
Superfamily Rho N-terminal domain-like 0.0000192
Family Rho termination factor, N-terminal domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) D1CBT1
Sequence length 642
Comment (tr|D1CBT1|D1CBT1_THET1) ATP-dependent helicase Rho {ECO:0000256|HAMAP-Rule:MF_01884} KW=Complete proteome; Reference proteome OX=525904 OS=Thermobaculum terrenum (strain ATCC BAA-798 / YNP1). GN=Tter_1339 OC=Bacteria; Thermobaculum.
Sequence
MDNTKNQELERNSEEIATTTITEIPADTRASDPQQSQQAHDTDKQPSDQIASDNVEPGNV
TSEKSSEDQLELPISEQRVENTPEVATEVPTSQQSSMHTQGDNSSNSKQADTSVVTEQSA
EPDPPVAEVTKVAEVGQQEEQAEHREDAAQEPSSTTTVAEEATSEAATPPEVDKAEEKPS
SKRSKKKPKQNNGRNGNNQQERTNGNNTAVAVAKKPSNETETVQAPTFTFAELQSMTKTN
LLALGRSLEVEVSGSMTKETLIYKILEAQANRAGYLLKQGILDIIEDGFGFLRQERYLPS
PDDVYVSQSQIRRFGLRTGDHVIGQVRAPKDNEKYHSLLRVEAVNYMDPEAARKRPFFDQ
LTPIFPNRQLVLETTPKQLSTRLIDLVAPIGRGQRGLIVSPPKAGKTTLLKDIANGITHN
YDDVHLMMLLIGERPEEVTDIRRSVEGEVVASTFDEPVEDHTKVAEMALERAKRLVECGK
DVVILMDSITRLARAYNLVVPASGRTLSGGIDPVALYPPKRFFGAARNIDEGGSLTIIAT
CLIDTGSRMDDVIYEEFKGTGNMELHLDRKLQERRIFPAIDVQRSGTRREELLIPEPKLQ
KIWTMRRMVSMLGGLEGTELLLNRLAKTENNEEFLNTLNKEL
Download sequence
Identical sequences D1CBT1
gi|269926445|ref|YP_003323068.1| WP_012875281.1.85100 525904.Tter_1339

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]