SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for D1CFW8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D1CFW8
Domain Number 1 Region: 176-313
Classification Level Classification E-value
Superfamily Riboflavin kinase-like 5.45e-43
Family ATP-dependent riboflavin kinase-like 0.00038
Further Details:      
 
Domain Number 2 Region: 22-181
Classification Level Classification E-value
Superfamily Nucleotidylyl transferase 5.04e-28
Family Adenylyltransferase 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) D1CFW8
Sequence length 324
Comment (tr|D1CFW8|D1CFW8_THET1) FAD synthase {ECO:0000256|PIRNR:PIRNR004491} KW=Complete proteome; Reference proteome OX=525904 OS=Thermobaculum terrenum (strain ATCC BAA-798 / YNP1). GN=Tter_0907 OC=Bacteria; Thermobaculum.
Sequence
MHRYISSLIHERPYREAPGPQVITMGTFDGLHLGHQAIIKKTLAVAEEHGLESTAITFHP
HPRYVLSGNKVPQLLPLEDRLDLLADMGINHVWCINFDLELAKLSAKEFFELLSKWVVPA
ALVVGENFRTGRNREAGVKELDVLGQELGWELISVPTLYIHGQPVSSTRIRHLLTQEGDV
ESAASLLGRNYYIKGTVVHGEGRGRQLGYPTANLSVSSDLVVPYNGIYYCDAYLDEPSTQ
PKVAAVSIGTRPTFGGGERTIEAYLLDWYGDLYDRTLKLEFIHRIRDELKFASVEDLIDQ
MDRDVANIRSLASSRLRNQVQQNR
Download sequence
Identical sequences D1CFW8
gi|269926023|ref|YP_003322646.1| WP_012874859.1.85100 525904.Tter_0907

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]