SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for D1CGI3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D1CGI3
Domain Number 1 Region: 1-128
Classification Level Classification E-value
Superfamily AF1862-like 2.75e-34
Family Cas Cmr5-like 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) D1CGI3
Sequence length 132
Comment (tr|D1CGI3|D1CGI3_THET1) CRISPR-associated protein, Cmr5 family {ECO:0000313|EMBL:ACZ42854.1} KW=Complete proteome; Reference proteome OX=525904 OS=Thermobaculum terrenum (strain ATCC BAA-798 / YNP1). GN=Tter_1948 OC=Bacteria; Thermobaculum.
Sequence
MSQTLSQQRAKYAMEKVLEVAKLEDNKKEDYSNFCLRLPGMILNNGLGQSLAFLLADAQK
NEQKMSYKLYEQLSEWIIMRRRIYPDEYGKNGLMKAILEGDRGAYVRAQTEVLELLGWMK
RFSDAYIGRPGQ
Download sequence
Identical sequences D1CGI3
gi|269838984|ref|YP_003323676.1| 525904.Tter_1948

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]