SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for D2AXA7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D2AXA7
Domain Number 1 Region: 201-488
Classification Level Classification E-value
Superfamily Subtilisin-like 2.23e-82
Family Subtilases 0.0000033
Further Details:      
 
Domain Number 2 Region: 783-905
Classification Level Classification E-value
Superfamily PA domain 0.000000392
Family PA domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) D2AXA7
Sequence length 1239
Comment (tr|D2AXA7|D2AXA7_STRRD) Subtilisin-like protein serine protease-like protein {ECO:0000313|EMBL:ACZ90834.1} KW=Complete proteome; Reference proteome OX=479432 OS=NI 9100). GN=Sros_8183 OC=Streptosporangium.
Sequence
MHWLARLTAAGAALSLALPALPSGAETASAPPPAAGLHRITLITGDVVTVRQAAAGKWAV
TVDPAKGREKVRFTTHDLDGKLQVLPDDMVPYVAENLVDKGLFAVGDLIEQGYDDAGSRT
LPLLLAYDKGARTSGALPGAKAGTELESIGARAVDAGKGELAAFWKAVEAAPSARSGGPR
LASGIRKIWLDAKVTADLEHSVPQIGAPDAWKSGFDGKGVKVAVLDTGADENHPDLAGKI
TDRRNFTADPSTQDGHGHGTHVATTVAGLGTASQGRRKGVAPGAELIIGKVLDSGGSGQF
SQIIEGMEWAAASGADVVNLSLGGEATDGTDPASAALNALTEQTGTLFVVAAGNEGREYA
VGTPGAATSALTVGAVGADETLAPFSSRGPRLDGGAKPDITAPGVAIVAARAEGTSMGQP
ADERYTAASGTSMATPHVAGAAAILKQRHPDWKAKQLKDALISTARTARDLTVYEQGGGR
VDVARAVRQDVTATGVLDLGTHQDGGSTAPSGTVAYTNSTQAAVSLALTATLSNLDGDAP
AQGALTLGSASITVDAGATVTVPVSADLAKLAHGRHSGHLTATTADGSVALQTTLALTRS
PRTHKVRISAVGKDGRPASVSTVFMFGPGTRDNLLTYIMPWEAEEGKTFEVPEGTYYAQS
QFGEERSGSRVIDIKIDIPEFPVTGDAELVFDARKTRPIVIKTPQPAVQEGISTFASYRD
TGTRKISSSFMNFPSVDELHVAETQPVRQGAFEFTSRWQYGAPRLSSRVSGLKGPLDLSP
TVRSPEWNGRYRWELVDGGHGTPEELGALKLRGRAVVMSSASQDDPQWDEMIAAAAEAGA
AAAVVVPAADDSPWQYWSPVMDRQAIPAAAIPYEQGKKLLERVRKGKAVLDVTGNMAIPY
LYDISQVSKGRIPEQIVYEANASNLARVDTGYHETGGFGWAKEQRFGWRPWQVFSNEGQR
WVRTGSARAEYVTSGDTEWEHVAQHMFTWESMRPLTPGLTGGLRSYAAGEKVGERWFGPV
VRPAVPPGRPESVPTRTGDTLRLDIPEFVDAAGHYGYAFSSDEEDTVSARFYRDGTLVEE
PRRAVGNFPAVPGKATYRMELSTKRSSEEWTYATETSTAWTFGSARPKSGSEPLPLLGVD
YTVPADLDGRVRRTLPVPLDFSVRSTAPGLALRQVTAELSYDDGKSWKRLVLLPRGKDRY
STLVSHQAGRGQYVSLRVTANDAAGNAVEQTVLRAYGVK
Download sequence
Identical sequences D2AXA7
gi|271969381|ref|YP_003343577.1| 479432.Sros_8183 WP_012894564.1.100029

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]