SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for D2AXI6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D2AXI6
Domain Number 1 Region: 7-275
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 7.42e-79
Family Protein kinases, catalytic subunit 0.0000000347
Further Details:      
 
Domain Number 2 Region: 511-571
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.000000942
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.013
Further Details:      
 
Domain Number 3 Region: 447-505
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.000012
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.012
Further Details:      
 
Weak hits

Sequence:  D2AXI6
Domain Number - Region: 380-441
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.00131
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) D2AXI6
Sequence length 618
Comment (tr|D2AXI6|D2AXI6_STRRD) Protein kinase {ECO:0000313|EMBL:ACZ83166.1} KW=Complete proteome; Reference proteome OX=479432 OS=NI 9100). GN=Sros_0111 OC=Streptosporangium.
Sequence
MTQPRRLGDRYELDGVVGRGGMAEVYRARDIRLDRIVAIKTLRADLARDHIFQARFRREA
QSAASLNHPSIVAVYDTGEDVAGSAPVPYIVMEYVDGRTLRDLLRADRRLLPERAAELVD
GILRALDYSHRGGIVHRDIKPANIMITNNGDVKVMDFGIARAMADSAATMTQTAQVIGTA
QYLSPEQARGERVDARSDIYSTGCVLYELLTGQPPFTGDSPVAIAYQHVREDPIPPSQID
PEIPKWADAIVLKAMAKDPAHRYQSAGEMRADIQRAMSGIPMDAQTMALANNYGSATRTM
QTPGPGGPATQRTTSVPAYEYGTEEGGRGERGRRRQQSSGNTAVKTAAWILVPLLVIGAF
IGVGYMFLSSPGDSSAANKIKVPALTSRTEAAATKALTDLGLTVKTVEKFDEESEKGTVI
ETSPAAGTAVDKGAEVTLTISKGVEKAEVPNVVNMTTDEAKAALEEAGFVPSVRTKASSG
PQDKVLETNPPAGKKAPKGSTVQIYVPKEAVEVPGVVNLTVGDAKRMLKEAGFKYKVVEQ
ESDLPEGTVLSQAPEAGAKLQQGTTITLVVSSGQAPQPTEPPTTDPTQEPPITEEPEPDP
TETEDPIFNEAPSDDLGG
Download sequence
Identical sequences D2AXI6
WP_012886912.1.100029 479432.Sros_0111 gi|271961713|ref|YP_003335909.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]