SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for D2B090 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D2B090
Domain Number 1 Region: 20-374
Classification Level Classification E-value
Superfamily Nitrous oxide reductase, N-terminal domain 1.28e-73
Family Nitrous oxide reductase, N-terminal domain 0.007
Further Details:      
 
Domain Number 2 Region: 341-419
Classification Level Classification E-value
Superfamily E set domains 3.55e-16
Family E-set domains of sugar-utilizing enzymes 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) D2B090
Sequence length 556
Comment (tr|D2B090|D2B090_STRRD) Uncharacterized protein {ECO:0000313|EMBL:ACZ89096.1} KW=Complete proteome; Reference proteome OX=479432 OS=NI 9100). GN=Sros_6378 OC=Streptosporangium.
Sequence
MPPTTRPRRGPRKRLTALVAAFALAATGLTALSTPAHAAAPGATAYVTNLRGNSVSVIDA
TTGTVSATVPVGTFPSGVAVSPDGAEVYVTNQGSNNISVIDAATNTVSATIPASQFPNPV
AFAPDGAHAYVGVSLGGGAQGVRVIDTATHTVTATVTVTGQPFDIAVTPDGGKAIVAGFV
GSTVSVIDTATNTVTATITSPSAQTPAGVVISPDGTHAYTANYNSNNVSVIDLATNTITG
TVPVASGPQDVSISPDGAHLYVTTASANAVAVIDTATSAVTTTIPVGTQPAGIRVNPADG
TAYVTNTATDDVSVIDLTTNAVTATIGVGDTPYNVDVSPARPIVTGLSPSSGPAAGGNTV
TITGSHLYSTSAVKFGGTPATNVTVVNATTVTATAPAHTPGTVHVTVTTQAGTSATGNAD
QYTYLPEPEADIDVDLTAQPHLGILVPYLSYTLTAHNTGPDAVTSATLTATLPPGATATN
LPAGCTAAATTVTCTYGTIANGASTGKTFRVPLHLLSLGHVTVTGVRATSAPTDPNTAND
TATKTCHVISIILATC
Download sequence
Identical sequences D2B090
479432.Sros_6378 gi|271967643|ref|YP_003341839.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]