SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for D2B809 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D2B809
Domain Number 1 Region: 353-979
Classification Level Classification E-value
Superfamily Six-hairpin glycosidases 6.24e-292
Family Cellulases catalytic domain 0.000000000000457
Further Details:      
 
Domain Number 2 Region: 44-144
Classification Level Classification E-value
Superfamily Carbohydrate-binding domain 2.51e-29
Family Cellulose-binding domain family II 0.0000487
Further Details:      
 
Domain Number 3 Region: 148-241
Classification Level Classification E-value
Superfamily PKD domain 0.0000576
Family PKD domain 0.012
Further Details:      
 
Weak hits

Sequence:  D2B809
Domain Number - Region: 249-351
Classification Level Classification E-value
Superfamily CalX-like 0.0199
Family CalX-beta domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) D2B809
Sequence length 979
Comment (tr|D2B809|D2B809_STRRD) Cellulose 1,4-beta-cellobiosidase {ECO:0000313|EMBL:ACZ83940.1} KW=Complete proteome; Reference proteome OX=479432 OS=NI 9100). GN=Sros_0936 OC=Streptosporangium.
Sequence
MPRFPIRAGALPRFRRRVAALALLSLAAGTTTALAASPAVAAISCEVTYATNDWQGGFTA
NVSIKNLGDPLNGWTLGFTFPDAAQKVTQGWSATWSQSGQAVTARNLDWNGNLATGASTS
IGFNGSWSGANPKPAAFTINGTTCGGTGPVNQPPTAKITKPVAGATFTAPATVDITADAA
DGDGTVAKVEFFNGTTLLGTDTTAPYAYSWAAVPAGDYSLTAKATDDKGSATTSAPVGIS
VQANSAPAVLLTPATLAVPEGGGADLSVKLSKAPSANVTVTTARTSGDADLTVASGGSLT
FTPANWNTAQTVRVAAAEDTDQTSGSAEFTSTATGHTPAKATATEVDNDTPGGDNEYVKR
FTTMYNKLKDPANGYFSPQGVPYHSVETFMVEAPDHGHETTSEAYSYYLWLEAAYGKVTG
DWSRFNDAWASMEKYIIPATADQPTNSFYNPSKPATYAGEWDDIKQYPSKLDGGVSVGSD
PIANELKTAYGTNDVYGMHWLLDVDNTYGFGRCGDGTTKPAYINTYQRGPEESVFETIPQ
PSCDTFKHGGKNGYLDLFTGDSSYAKQWKYTNAPDADARAVQVAYWAHTWAKEQGKEAQV
ASSVTKAAKMGDYLRYAMYDKYFKKQGCTSTTCPAGTGKDSSAYLLSWYYAWGGANDTSA
GWAWRIGSSHNHSGYQNPMAAWALSSVDALKPKGATAVQDWSTSLKRQLEFYRWLQSSEG
AIAGGATNSWQGHYAAPPSTLPTFYGMAYDWQPVYHDPPSNQWFGFQAWSMERVAELYYA
TGNADAKLVLDKWVKWATDNTTVNADGTFRIPSTLVWTGQPDTWNSGNPGPNAGLHVSIR
DYTSDVGVAGSYAKVLTYYAAKSGNATAKAVAKGLLDGLWKNNQDAKGVSVPETKADYNR
LNDPVYVPPGWTGKMPNGDVIDSSSTFMSIRSFYKNDPDWPKVDAYLKGTGPVPSFNYHR
FWAQVDVAVALAEYGRLFP
Download sequence
Identical sequences D2B809
gi|271962487|ref|YP_003336683.1| 479432.Sros_0936 WP_012887686.1.100029

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]