SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for D2C7Q5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D2C7Q5
Domain Number 1 Region: 9-279
Classification Level Classification E-value
Superfamily FAD-linked oxidoreductase 1.14e-54
Family Methylenetetrahydrofolate reductase 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) D2C7Q5
Sequence length 281
Comment (tr|D2C7Q5|D2C7Q5_THENR) Methylenetetrahydrofolate reductase {ECO:0000256|RuleBase:RU003862} KW=Complete proteome OX=590168 OS=RKU-10). GN=Tnap_0900 OC=Bacteria; Thermotogae; Thermotogales; Thermotogaceae; Thermotoga.
Sequence
MRKSLETGKCVVLEVLTPRGTNLSKFMEFTEEAWKTGIDAFTVTDMPMGRVRMAPWAASH
LLVESGKDVLMHFTRNTRNMIRIQSDLLGCHALGVKNLLLLSGDNPSHGDYPETTSVNDI
DILDLIRLTKLMNEGTDLAGNKIYGKTDFFVGGALNPFSDEDVERAKQKIEAGVDFLVTQ
PLFNSEVAKKIKEELNTKILASIVFFENAKQMSYFSNVPGIEIPDEIVNSAEKGDDYLKE
KSFESVLRFVEETKDVLDGFYIVAIVKDLEKIRKVVEIAKS
Download sequence
Identical sequences D2C7Q5
gi|281412326|ref|YP_003346405.1| WP_012896219.1.51822 590168.Tnap_0900

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]