SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for D2H4H4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D2H4H4
Domain Number 1 Region: 691-837
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 1.06e-39
Family Regulator of G-protein signaling, RGS 0.00011
Further Details:      
 
Domain Number 2 Region: 1017-1116
Classification Level Classification E-value
Superfamily Ubiquitin-like 3.1e-30
Family Ras-binding domain, RBD 0.00079
Further Details:      
 
Domain Number 3 Region: 216-372
Classification Level Classification E-value
Superfamily PH domain-like 1.78e-20
Family Phosphotyrosine-binding domain (PTB) 0.0094
Further Details:      
 
Domain Number 4 Region: 12-98
Classification Level Classification E-value
Superfamily PDZ domain-like 8.79e-20
Family PDZ domain 0.0097
Further Details:      
 
Domain Number 5 Region: 962-1031
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000000000000439
Family Ras-binding domain, RBD 0.077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) D2H4H4
Sequence length 1423
Comment (tr|D2H4H4|D2H4H4_AILME) Uncharacterized protein {ECO:0000313|EMBL:EFB15591.1} OX=9646 OS=Ailuropoda melanoleuca (Giant panda). GN=PANDA_004693 OC=Ailuropoda.
Sequence
MYRAGDAVERPPHGPAPPRMRSVEVARGRAGYGFTLSGQAPCVLSCVMRGSPADFVGLRA
GDQIFAVNEINVKKASHEDVVKLIGKCSGVLHMVIGEGIGHVESCSSDEEVGFYEGKAWL
KPKLDSKALGINRAERVVEEVQSGGIFSMIFENPSLRAGSSEPLKLKQRSLSESAAARFD
LGRESVSHLNPGLLSREEISRVITDDSVFSVGPENHDDYALDASILNVAMVVGYLGSIEL
PSTSCNLESDSLQAIRGCLRRLRAEQKIHSLVTMRVLHDRVQLCTEQATVLAEYPAEKLA
FSAVCPDDRRLFGLVTMQSSDDGSLAHEEEGALRTSCHVFMVDPDLFNHKIHQGIARRFG
FECTADPDTNGCLEFPASSLPVLQFISVLYRDMGELIEGVRARAFVDGDADAHQNTSTSS
NSDSGIGNFHQEERSSRVIVVDLGASSSRHGPSNGGWEGAGGRGSQPWGAPWNGAFCHDP
EGGPPFEAAPQADRCRDFSKHLGPTSYAEVPPASLRSSVPPSKRGAAGHSGGFGQRWLPV
HVLQEWQCGHASDQESYTDSTDGWSSVNCGTLPPPMSKIPADRYRVEGSMAQPPLSAQKR
DWSRKAFGMPNIFGPHRQVRKTKEDKKGSKLGRGIGLTQTSQRTSARRSFGRSKRCSVTR
SLDDLESATVSDGELTGAELKDCVSNHSLSSNASLPSVQSCRRLRERRAASWAVSFERLL
QDPLGVRYFSDFLRKEFSEENILFWQACEYFNHVPAHDKKELSYRAREIFSKFLCSKATT
PVNIDSQAQLADDILSAPHPDMFKEQQLQIFNLMKFDSYTRFLKSQLYQECILAEVEGRS
LPDAQQVPSSPASKHSVSSEHSSVSTPKKLSGKSKSGRSLNEELGDEDSEKKRKGAFFSW
SRTRSTGRSQKKKEHGDHANEPLHANGGLGRRESQGSVSSTGSLDLSEACRPSVPERDKA
AKHCCVQLPDGTSCVVVVKAGLSIKEVLTGLCERHGINGAAVDLFLVGGDKPLVLHQDSS
ILESRDLRLEKRTLFRLDLVPINRSVGLKAKPTKPVTEVLRPVVAKYGLHLNELVARLSG
EKEPLDLGAPISSLDGQRVILEEKEPSRGKGSTEKQKSAPAKQNIAVNSSSRNHSATGEE
RTLGKSNSIKIKGENGKNARDPRLSKREESIAKIGKKKNQKINLDEAEEFFELISKAQSN
RADDQRGLLRKEDLVLPEFLRLPPGPVELALPPPTATKSFGRRSLTSNGKDKAPRPPESW
GPARETSPVMSPATSPATSPSSAYSPPFSAPQTPSPHAQEAEAGGVQTMEGEHVADLTLM
GEGDISSPNSTLLPPTPTPQDAAGPPRPGGGARGSQGLPVNTIIDVDRVAGVAPGRGSSV
PRVRTGPQRSRASGALTSDVPSLSPVAGGPAKPKASPHHATFV
Download sequence
Identical sequences D2H4H4
XP_002916597.1.58354

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]