SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for D2HQU3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D2HQU3
Domain Number 1 Region: 793-924,987-1053
Classification Level Classification E-value
Superfamily Hemopexin-like domain 1.44e-40
Family Hemopexin-like domain 0.0011
Further Details:      
 
Domain Number 2 Region: 43-82
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.00000000314
Family Somatomedin B domain 0.0013
Further Details:      
 
Domain Number 3 Region: 2-42
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.0000000068
Family Somatomedin B domain 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) D2HQU3
Sequence length 1053
Comment (tr|D2HQU3|D2HQU3_AILME) Uncharacterized protein {ECO:0000313|EMBL:EFB28756.1} OX=9646 OS=Ailuropoda melanoleuca (Giant panda). GN=PANDA_014295 OC=Ailuropoda.
Sequence
DLPSCAGRCGEGYSRDATCNCDYNCQHYMECCPDFKKVCTMELSCKGRCFESFARGRECD
CDSECKKYGKCCPDYENFCGRVHNPPTPPSSKTAPPPPGAPQTIKSTTKRSPKAPNKKKT
KKVIESEEITEEHSVSENQESSSSSSSSSSTIRKIKSSKNSAANKELKKKPKVTDNKKEK
TPKKKPTPEQPVVDEAGSGLDNGDIKLTPTPDTPTTERNKVTTPPKITTGKPINPKPSLP
PDSDTSKGTPSTPNKETTVETKETSLTNKETSSGTKEKTISTKETRSAEKTPAKDSVPTS
KAPVKSTPKPETTTKSPTPTTTKEPTPTTPKEPTPTTPKKPALTTTKKHTPTTTKEPTPT
TPKKPALTTTKKHTPTTTKEPEPTTPKEPTPTTPKEPAPTTPKEPTPTTPKEPAPTTPKE
PXTPKEPEPTTPKEPIPTISKEPEPTISKEPEPTTPKEPEPTTPKEPEPTTSKEPAPTTP
KKPAPTTTKEPAPTAPKKLAPTAPKEPTPKLPKKPAPASLETPAPTTSEVTTTTTTMEPP
TTPKNPAESTPEFPAEPTPEALENSPKETSVSNTKAPEVTEPEMTTTAKDKTEKDIHRIP
ETEETTAPKTSTATQVTSITSSKITPKATTLAPKVMTTTKKTTTTEETVNKPEETTAVPK
DTATTPKVSTSKPRKPTKALKRPTSTKKPNTIPKGRKPKTTAIPPKMTTSTMPRLHPTSS
AEAVLTTTSPNQRLNSEIVEVNPNKDAAIAGEKPHMIPRPPVLTPIFIPGTDILVRGSNQ
DIAINPMLSDETNLCNGKPVDALTTLHNGTLVAFRGHYFWMLSAFNPPSPPRKITEVWGI
PSPIDTAFTRCNCEGKTFFFKDSQYWRFTNDIKDPGYPKQIAKGFGGLNGKIVAALSIAK
YEDRPESVYFFKRGGSIQQYIYKQEPIKKCPGRRPAISYSVYGETTQVRRRRFERAIGPS
QTHTIRIHYSPVRVSYQDKGFLHNEVKMSLQWRGFPNVVTSAIALPNIRKPDGYDYYAFS
RNQYYNIDEPSRTARVVTTRFGRSLSNVWYKCP
Download sequence
Identical sequences D2HQU3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]