SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for D2PJP6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D2PJP6
Domain Number 1 Region: 7-209
Classification Level Classification E-value
Superfamily FAD-binding/transporter-associated domain-like 4.02e-31
Family FAD-linked oxidases, N-terminal domain 0.0052
Further Details:      
 
Domain Number 2 Region: 385-410
Classification Level Classification E-value
Superfamily FAD-linked oxidases, C-terminal domain 0.00000425
Family Vanillyl-alcohol oxidase-like 0.059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) D2PJP6
Sequence length 411
Comment (tr|D2PJP6|D2PJP6_SULID) FAD linked oxidase domain protein {ECO:0000313|EMBL:ADB86999.1} KW=Complete proteome OX=425944 OS=Sulfolobus islandicus (strain L.D.8.5 / Lassen #2). GN=LD85_1330 OC=Sulfolobus.
Sequence
MFMMKLDELEKELGSKLIMNDNVIDHYSKSPYLVSPILSKMGKRVLGVVIVEDRYDVEFV
VKFCDIHRIPLLARGAGTSTIGQVLPIHPSIVLDIQKLNKTMEYDEKYLKISPGVKVLDA
LNYLRKRGKELQVYPSSFYISTLGGYIAGGDVGIGSYQYGYHFHNGGIRRVKIVGPTGTF
ELTGENTLAVAQAAGTTGIIIGADIATVDYEDWKDQIIRFDELGKLVKFLKDAENERDKI
RRITIEDQEALSLVAKNRVAPGKWNVIVASTKSFGEEVDMKFLDELAFAAIYVTMSRLTN
FSDYFYEVRLLSLNSFLKVVSQVKDALGSNVLIHGDVMTLRGETVIYTVFISDRLNFDII
DSIMTKEGIPFEIHSLVVNDRVDEEYRLELMKKYKRIVDPHDILNPGKLRV
Download sequence
Identical sequences C3MPK5 C3NHW7 D2PJP6
gi|229582250|ref|YP_002840649.1| WP_012713630.1.34992 WP_012713630.1.52267 WP_012713630.1.66823 gi|284997602|ref|YP_003419369.1| gi|227830183|ref|YP_002831963.1| 419942.YN1551_1641 429572.LS215_1309

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]