SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for D2PKT9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D2PKT9
Domain Number 1 Region: 7-176
Classification Level Classification E-value
Superfamily Prim-pol domain 1.5e-21
Family Bifunctional DNA primase/polymerase N-terminal domain 0.01
Further Details:      
 
Weak hits

Sequence:  D2PKT9
Domain Number - Region: 225-295
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 0.00922
Family Bacterial dinuclear zinc exopeptidases 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) D2PKT9
Sequence length 307
Comment (tr|D2PKT9|D2PKT9_KRIFD) Bifunctional DNA primase/polymerase {ECO:0000313|EMBL:ADB32406.1} KW=Complete proteome; Reference proteome OX=479435 OS=Kribbella flavida (strain DSM 17836 / JCM 10339 / NBRC 14399). GN=Kfla_3346 OC=Kribbella.
Sequence
MTTPTPILTAALDAAGRGWPVFMLGRSKRPVANCETCRPVNGQPPHDPWSCGHLTCHGFY
AATTDTARVAAIVNAVPGGQLAVRTGMVSGLLVVDVDPAHGGWESLSELVARQLVPRTLW
VRTGSDGAHLYYRHPGLHMPSRPMPNRPGIDVKADGGYVVLPPSIHHRTRRPYAWGTGSD
LADPAAVVEMPPPLIAACLPATPAESTHAPSAPLSGPQRDTGGGGISHPDKLLTAHLDAV
RQAPQGKRRTTLYGAARGVARMVAAGALDPAAAVAALTYAGHQAAQTDRDIRAAIAGGFR
DEGITAA
Download sequence
Identical sequences D2PKT9
WP_012920962.1.69711 gi|284031274|ref|YP_003381205.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]