SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for D2PN82 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D2PN82
Domain Number 1 Region: 2-184
Classification Level Classification E-value
Superfamily Prim-pol domain 5.36e-24
Family Bifunctional DNA primase/polymerase N-terminal domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) D2PN82
Sequence length 292
Comment (tr|D2PN82|D2PN82_KRIFD) Bifunctional DNA primase/polymerase {ECO:0000313|EMBL:ADB34566.1} KW=Complete proteome; Reference proteome OX=479435 OS=Kribbella flavida (strain DSM 17836 / JCM 10339 / NBRC 14399). GN=Kfla_5560 OC=Kribbella.
Sequence
MTHLLNAALDAAGRGWPVFMLGRSKRPVANCADCPKDAHAPDTCGHLTCHGFYAATTDPA
RLAAIINAVPGGQLAVRTGAVSGLAVIDVDPAHGGDASLSDLMTAGLVPRTRHVHTGSGG
LHLYYRHPGQHLPSRPMPNRPGIDVKADGGYVVLPPSIHHRTHRPYRWGTAGNDVVEMPP
ALVTACLPAPTPAESHTHPRTPVATTAGGGISHPDRLLSAHLDAVRNAPTGKRRTTLYGA
ARGVARMVAAGALDRTDAITALTDVGHQAAQTPRDIQAAITSGFRDEGIAAA
Download sequence
Identical sequences D2PN82
gi|284033434|ref|YP_003383365.1| WP_012923120.1.69711

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]