SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for D2QDC8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  D2QDC8
Domain Number - Region: 45-106
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.000116
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0071
Further Details:      
 
Domain Number - Region: 185-211
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0157
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) D2QDC8
Sequence length 258
Comment (tr|D2QDC8|D2QDC8_SPILD) PASTA domain containing protein {ECO:0000313|EMBL:ADB36358.1} KW=Complete proteome; Reference proteome OX=504472 OS=Spirosoma linguale (strain ATCC 33905 / DSM 74 / LMG 10896). GN=Slin_0294 OC=Spirosoma.
Sequence
MAKISTRSFFDLLIHIGIILALIAALFLVFFFVYLPYTTNHGQTITVPDVTRLSLDEMEN
LLDDRDLRYEVSDCTFVAGAQPLTVIQQYPRANAKVKEGRKIYLTITKRVAPMVQMPNLV
NLTLRSAELNLKSLDLVSGPPIYVPDVAKNAVLRQLYNGKEITPGTPIPKGAQIDLEVGD
GLGSTMFEIPNVVGLPVDEAEAAIRGSNLKVGTKISVDDPEKEVGTVIRQRPEARSGERI
RVGETMDLWIVGPIEPDQ
Download sequence
Identical sequences D2QDC8
gi|284035227|ref|YP_003385157.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]