SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for D2QIM6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D2QIM6
Domain Number 1 Region: 27-134
Classification Level Classification E-value
Superfamily YjgF-like 2.04e-28
Family YjgF/L-PSP 0.00065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) D2QIM6
Sequence length 134
Comment (tr|D2QIM6|D2QIM6_SPILD) Endoribonuclease L-PSP {ECO:0000313|EMBL:ADB39952.1} KW=Complete proteome; Reference proteome OX=504472 OS=Spirosoma linguale (strain ATCC 33905 / DSM 74 / LMG 10896). GN=Slin_3962 OC=Spirosoma.
Sequence
MTGLGSSTRSLAASTAEKEATSIVSQDDIPLYSGSTKLGNLVFVSGAGAHFEGDIRSHTD
HVLKEIEKELIKAGSSMDKVLKVNVLLHDLKDYKAMNEVYKGRFGKNPPVRTTVAVHAGV
PGNSWVEIDCVAYV
Download sequence
Identical sequences D2QIM6
gi|284038821|ref|YP_003388751.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]