SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for D2QWF1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D2QWF1
Domain Number 1 Region: 198-249
Classification Level Classification E-value
Superfamily Homeodomain-like 0.0000000000000851
Family AraC type transcriptional activator 0.012
Further Details:      
 
Domain Number 2 Region: 27-130
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.000000000000366
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.073
Further Details:      
 
Domain Number 3 Region: 148-196
Classification Level Classification E-value
Superfamily Homeodomain-like 0.00000000115
Family AraC type transcriptional activator 0.06
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) D2QWF1
Sequence length 255
Comment (tr|D2QWF1|D2QWF1_PIRSD) Transcriptional regulator with PAS/PAC sensors, AraC family {ECO:0000313|EMBL:ADB17754.1} KW=Complete proteome; Reference proteome OX=530564 OS=staleyi). GN=Psta_3090 OC=Planctomycetaceae; Pirellula.
Sequence
MTTFDAKQFQSDFFQRLPLADSVMRLFDALPHTYFYAKDRESRFVKVNHPFLENHGLSRE
EEALGKTDRDFHPPILAEAYIAEDRRVMARGEVVPGQIWPVLHRRQLPRWYVSTKAPLFG
ADGKVIGLAGAMYRIADPDDLTRYFQELTPVVRYFDQHYAETISMKEMAQLAGQSATHFH
RRFRQLLHMNPTQYLRTVRIQNAQHMLTTSSRSLADIATAVGFTDQSHFTKRFRQSTGLT
PDVYRRRFMSPSVSS
Download sequence
Identical sequences D2QWF1
WP_012912016.1.69553 gi|283780859|ref|YP_003371614.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]