SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for D2QZT0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D2QZT0
Domain Number 1 Region: 2-123
Classification Level Classification E-value
Superfamily NTF2-like 1.8e-23
Family Limonene-1,2-epoxide hydrolase-like 0.09
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) D2QZT0
Sequence length 156
Comment (tr|D2QZT0|D2QZT0_PIRSD) Limonene-12-epoxide hydrolase {ECO:0000313|EMBL:ADB16563.1} KW=Complete proteome; Reference proteome OX=530564 OS=staleyi). GN=Psta_1889 OC=Planctomycetaceae; Pirellula.
Sequence
MSDIDLIHRWLKAFQSSDYDTMATCYHPDATFTDIAFVLQGQKQIHAMWHMICENGIEVE
LRESPRASGETVTTKIIDTYKLSNTGRQVKNPVLCTFRFREGKIIEQRDECDPIAWAAQA
FGGIKGWFVGRIGLLRRIAARKKIEAFIQQHPQYAE
Download sequence
Identical sequences D2QZT0
WP_012910826.1.69553 gi|283779668|ref|YP_003370423.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]