SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for D2R1Z6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D2R1Z6
Domain Number 1 Region: 3-52
Classification Level Classification E-value
Superfamily CsrA-like 0.0000000000000109
Family CsrA-like 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) D2R1Z6
Sequence length 111
Comment (tr|D2R1Z6|D2R1Z6_PIRSD) Translational regulator CsrA {ECO:0000256|SAAS:SAAS00970184} KW=Complete proteome; Reference proteome OX=530564 OS=staleyi). GN=Psta_3953 OC=Planctomycetaceae; Pirellula.
Sequence
MVILVLSRKVGEKLVIGGNITVVVSKVAGNRVTLGIEAPSDVRVIRGELQFEVELPEASA
EVVASEADDHATVPFDPAAVRSAERTPVRGNTPLAGRVARTRSDATPRLAK
Download sequence
Identical sequences D2R1Z6
gi|283781712|ref|YP_003372467.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]