SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for D2R2P6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D2R2P6
Domain Number 1 Region: 46-363
Classification Level Classification E-value
Superfamily NHL repeat 7.06e-41
Family NHL repeat 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) D2R2P6
Sequence length 364
Comment (tr|D2R2P6|D2R2P6_PIRSD) NHL repeat containing protein {ECO:0000313|EMBL:ADB16886.1} KW=Complete proteome; Reference proteome OX=530564 OS=staleyi). GN=Psta_2215 OC=Planctomycetaceae; Pirellula.
Sequence
MVKVTSLVLVLLGCLTLALTLEAGTIDTVAGTGKPADGPASGLGVETNVGDPFGVEIGPD
GALYITEVRNHRVRRLDLKTGAMTTVAGSGKMGYAGDGGPATEALLNEPYEVRFDSHGNM
IFVEMKNFVIRKVDAKTGIISTIAGSGKEGFAGDGGPAKEAVFSIPHSIALDADDNIYVC
DLGNHRIRKIDAKTGLISTIAGNGGKTLPKEGKIDGTMSLLGPRAVCIDKNVMWIALREG
HSVWKLNLATSELTHIAGTGKKGFSGDGGPAKDATFDGPKGVAVCPDGGVVVVDTENHVI
RKIDVKAGTISTVPGHTPKKAGGDGDGGDATKATMNRPHGICVDKDGSIYIGDTLNHRVR
RVRE
Download sequence
Identical sequences D2R2P6
WP_012911148.1.69553 gi|283779991|ref|YP_003370746.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]