SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for D2R2Q0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D2R2Q0
Domain Number 1 Region: 55-214
Classification Level Classification E-value
Superfamily NTF2-like 3.47e-28
Family BaiE/LinA-like 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) D2R2Q0
Sequence length 377
Comment (tr|D2R2Q0|D2R2Q0_PIRSD) Uncharacterized protein {ECO:0000313|EMBL:ADB16890.1} KW=Complete proteome; Reference proteome OX=530564 OS=staleyi). GN=Psta_2219 OC=Planctomycetaceae; Pirellula.
Sequence
MVRCKKLAPSWFSVSLIRMAGLAAVPWLLGLTAVSAQEKQPPAAPAVAAEKPAKTAAEDA
EILAMTRNYAAAYTQNDAKLVASYWAEKGVYIDPETGTSIEGREKIEAAFAKNFASEKGT
SLQVAVQSIRGISPDVAEVAGIAVVSVPGGVSSESSFVAMLVKQAGGWKIDSVRESETAV
PVSNYERLADLEWMVGEWKEEAGETKIFTRCRWIANRNFLLRSFTVMQGEEVQLAGTQII
GYDASIGTMRSWVFDTDGGFGEGVWAATKGESGEAKWTVKMSGVLQDGRRAAATQVITKI
DKDKATFQTVGREVDGELLPSSPAVTVVRVASSDVDANSSLGDVAVPTASSADSAAPSDN
PRDKNEAPAPQQPAESK
Download sequence
Identical sequences D2R2Q0
gi|283779995|ref|YP_003370750.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]