SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for D2R2Z4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D2R2Z4
Domain Number 1 Region: 6-96
Classification Level Classification E-value
Superfamily NTF2-like 0.00000000216
Family Rv3472-like 0.061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) D2R2Z4
Sequence length 108
Comment (tr|D2R2Z4|D2R2Z4_PIRSD) Uncharacterized protein {ECO:0000313|EMBL:ADB18727.1} KW=Complete proteome; Reference proteome OX=530564 OS=staleyi). GN=Psta_4075 OC=Planctomycetaceae; Pirellula.
Sequence
MTLNLPQPVAAYFAADKASGESVAQCFAENAVVKDEGHTYNGRAAIKKWKEEAASKYEYT
CEPLTCESHNSKSIVTCRLVGNFPGSPIDLRFAFELAGEQIASLEVAP
Download sequence
Identical sequences D2R2Z4
WP_012912986.1.69553 gi|283781832|ref|YP_003372587.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]