SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for D2R5V2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D2R5V2
Domain Number 1 Region: 85-178
Classification Level Classification E-value
Superfamily Ribosomal protein L6 3.93e-31
Family Ribosomal protein L6 0.0000507
Further Details:      
 
Domain Number 2 Region: 1-84
Classification Level Classification E-value
Superfamily Ribosomal protein L6 7.07e-21
Family Ribosomal protein L6 0.00089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) D2R5V2
Sequence length 181
Comment (tr|D2R5V2|D2R5V2_PIRSD) 50S ribosomal protein L6 {ECO:0000256|HAMAP-Rule:MF_01365, ECO:0000256|RuleBase:RU003870} KW=Complete proteome; Reference proteome OX=530564 OS=staleyi). GN=Psta_2615 OC=Planctomycetaceae; Pirellula.
Sequence
MSRIGNKPVPVLDGVKVSLSGRKVLVEGPKGKLEWEPSKPISVEVDAATKEIVVKRVDDE
RESRALHGLSRAIINNMIIGVKNGYEKRLEVVGVGYVVSLKGTILNLRVGLANELKREIP
AGLTVTCPDQTHIVIQGCDKQKVGQFAAELRSLRKPEPYKGKGVRYQGETIKLKPGKAAT
K
Download sequence
Identical sequences D2R5V2
WP_012911546.1.69553 gi|283780389|ref|YP_003371144.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]