SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for D2R6C6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D2R6C6
Domain Number 1 Region: 8-382
Classification Level Classification E-value
Superfamily Ammonium transporter 1.83e-109
Family Ammonium transporter 0.00000516
Further Details:      
 
Domain Number 2 Region: 653-826
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 5.89e-49
Family Histidine kinase 0.00037
Further Details:      
 
Domain Number 3 Region: 1022-1148
Classification Level Classification E-value
Superfamily CheY-like 2.56e-31
Family CheY-related 0.0064
Further Details:      
 
Domain Number 4 Region: 842-968
Classification Level Classification E-value
Superfamily CheY-like 1.11e-27
Family CheY-related 0.0079
Further Details:      
 
Domain Number 5 Region: 585-665
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 6.08e-21
Family Homodimeric domain of signal transducing histidine kinase 0.0021
Further Details:      
 
Domain Number 6 Region: 1127-1140,1197-1297
Classification Level Classification E-value
Superfamily Histidine-containing phosphotransfer domain, HPT domain 1.24e-19
Family Phosphorelay protein-like 0.06
Further Details:      
 
Domain Number 7 Region: 449-578
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 1.24e-16
Family Flavin-binding PAS domain 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) D2R6C6
Sequence length 1314
Comment (tr|D2R6C6|D2R6C6_PIRSD) Multi-sensor hybrid histidine kinase {ECO:0000313|EMBL:ADB15504.1} KW=Complete proteome; Reference proteome OX=530564 OS=staleyi). GN=Psta_0819 OC=Planctomycetaceae; Pirellula.
Sequence
MESAPAYANLIWVLVCAALVMFMQAGFCMLETGFSRAKNSINVAIKNLIDFCLSGLIYWA
FGFAIMFGSSYFGFFGKSMFLLDGSQTPWLLAIFLFQMMFCSTATTIISGAVAERIRFSA
YLLVAMFVSGLIYPVFGHWAWGGGVEGVATGWLAKLGFIDFAGSTVVHSIGGWCALAITL
ILGPRFGRFTDRTQPMHGHSLALSTLGALTLWFGWFGFNGGSTLAINSSVPIILVNTNLA
AAAGGVAALLLAWRCEKLPSVSQGINGVIAGLVGITASCHLVEPMGAVTIGAVSGMIAVL
GTYLLERYKIDDVVGAVPVHGMSGAWGTLAVALFVSVDKFPLGNSRIDQIGIQGIGVLCC
FAWAFAVPWCVFSVVNYFRPLRTDLHHELQGLNVTEHGASTELIDLLVNMDRQRQRGDFS
QPVHVEPHTEVGQIAAEYNRVIDCVNQEIIAREQAIAAARTAEEKFRSIFENAVEGIFQT
TPSGEYLSANPKLARIYGFETVADMQTGLQDISRQLYVDPARRAEFCSLLEQTDVVIGFE
SQVYRADGSIIWISENARAIRDEQGQVKYYEGTVEEITQRKLNADLKAEKEAAVAASQAK
SAFLANMSHEIRTPLNGVIGMLELLGTTTLDERQNRYVHIARSSAGTLLGLINDVLDFSK
IEAGKLELERVQFDLHSLLEDVAEMFSHRANEKGLELSCRILPGVPTNVYGDPERIRQVL
INLVNNAIKFTKQGEVILRAEQQVHSSGVSRMRISVIDTGIGIPADRSSQLFAPFTQVDA
STTRKYGGTGLGLAICRQLIELMGGRVGVDSVEGNGSTFWCEVPLEVAQVNTAPRSPVAE
TLRGLAVLTVDDTDTNLEILHDQLTSWGMRVTAARDGLQALAQLRTAVRSGKKYPLVILD
HQMPEMDGLQLAAAIKGDALLRDTNLLMLTSVDQLVDRSKWSSLGLAGVMTKPIRQSRLF
DAIAGVLKHQESLPALPDSDSSATLPAPAAPTKPVMLREVASAPAYSRTEGATPQEILAQ
CGLKLLVAEDNEINQMVTSEILRGSGYACDVVSNGNQAIDALVRGGYALVLMDCQMPELD
GFAATKKIRALEQSGSLTHAVQGPMPVVALTANAVYGDRDVCLAAGMNDYTTKPVDRAIL
LGTIARNLQPVIEKIPLQTSTPPQATQSPAEPSSAASDESTAANPGAPVELPEELGPVIV
IPELLSRCACDTGFAGSMLRRFQSRLPEEYARLAEAVKNQDTVPARKMAHTLKGTAANLA
AAGVRTAAAQLELALHDERHDESARCLGQLEFEVERCLSHLDTLLAGELAADAT
Download sequence
Identical sequences D2R6C6
WP_012909769.1.69553 gi|283778609|ref|YP_003369364.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]