SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for D2R6Q2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D2R6Q2
Domain Number 1 Region: 1-52
Classification Level Classification E-value
Superfamily CsrA-like 1.57e-18
Family CsrA-like 0.00081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) D2R6Q2
Sequence length 75
Comment (tr|D2R6Q2|D2R6Q2_PIRSD) Translational regulator CsrA {ECO:0000256|SAAS:SAAS00970184} KW=Complete proteome; Reference proteome OX=530564 OS=staleyi). GN=Psta_2683 OC=Planctomycetaceae; Pirellula.
Sequence
MLVLSRKKDERIVINGNIVITVVEVKGDKVRIGIEAPHEVPVHRHEVFEALARAHREIAN
GATKPDLPPVSTTER
Download sequence
Identical sequences D2R6Q2
gi|283780457|ref|YP_003371212.1| WP_012911614.1.69553

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]