SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for D2R8P9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  D2R8P9
Domain Number - Region: 46-119
Classification Level Classification E-value
Superfamily MFS general substrate transporter 0.00628
Family Glycerol-3-phosphate transporter 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) D2R8P9
Sequence length 173
Comment (tr|D2R8P9|D2R8P9_PIRSD) Caa(3)-type oxidase, subunit IV {ECO:0000313|EMBL:ADB17590.1} KW=Complete proteome; Reference proteome OX=530564 OS=staleyi). GN=Psta_2925 OC=Planctomycetaceae; Pirellula.
Sequence
MGHASGSHTHTHVPGGVGKYVAVFVALCVLTAISFAVGNSQQLRENAPGVMMAMMMAVSC
AKASLVILFFMHLKYEANWKYVLTIPASIMSFFLVLMLIPDIARRTNYYTEERWLYAAEE
QTHHAGEHHDEEHAGGEHGASEHDHKAEAHDAAKPATETPATDAPAEAAEAKP
Download sequence
Identical sequences D2R8P9
gi|283780695|ref|YP_003371450.1| WP_012911852.1.69553

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]