SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for D2RQ16 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D2RQ16
Domain Number 1 Region: 119-170
Classification Level Classification E-value
Superfamily NAD kinase/diacylglycerol kinase-like 0.000000034
Family Diacylglycerol kinase-like 0.074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) D2RQ16
Sequence length 386
Comment (tr|D2RQ16|D2RQ16_HALTV) ATP-NAD/AcoX kinase {ECO:0000313|EMBL:ADB60275.1} KW=Complete proteome; Reference proteome OX=543526 OS=VKM B-1734) (Halococcus turkmenicus). GN=Htur_1387 OC=Haloterrigena.
Sequence
MDSLGVVVNPIAGMGGRVGLKGTDGKLEEARRRGAEPRAPERAREALRSLHRRAPGVTVY
TAAGVMGERAVRDAGYEPIVVYEPTADDADLADATVSVDADTDPSDTSRPVDPATAETTA
ADTRAAVRAFLERDVDLVLFVGGDGTAVDVADVLEESEGDETPMLGVPAGVKIYSSVFAV
TPADAGRIAAEFDRAADREVNDIDEDAYREGEVRSQLEAIVPVPVAPDVQSSKQVSSGSV
DSLAAGFAREVDRERTYVFGPGSTVGAIERELEIDPSPLGVDVWRDGEVLARDAAESDIL
DVLEAPATIVVSPIGGQGFVFGRGNHQISPAVIERADEIEVVASGEKLDGIDALHVDTDD
EAIDEELRGWLRVRTGRFTTRLVKVV
Download sequence
Identical sequences D2RQ16
WP_012942580.1.92728 gi|284164669|ref|YP_003402948.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]