SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for D2S8Q2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D2S8Q2
Domain Number 1 Region: 90-156
Classification Level Classification E-value
Superfamily C-terminal domain of arginine repressor 3.92e-17
Family C-terminal domain of arginine repressor 0.0011
Further Details:      
 
Domain Number 2 Region: 3-72
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 2.09e-16
Family Arginine repressor (ArgR), N-terminal DNA-binding domain 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) D2S8Q2
Sequence length 178
Comment (tr|D2S8Q2|D2S8Q2_GEOOG) Arginine repressor {ECO:0000256|HAMAP-Rule:MF_00173} KW=Complete proteome; Reference proteome OX=526225 OS=G-20). GN=Gobs_3023 OC=Geodermatophilus.
Sequence
MTTALTRSARQARIRELIQAQPVTSQTQLAALLAGSGIEVTQATLSRDLEELGAVKLRGS
DGAPASYVVPPENAPLRPAQAAPARLTRLLGDLLTSAEGSANLAVVRTPPGAAQFLASAL
DKVGLPDVLGTIAGDDTLLVVSRRPDGGAALADRLRALAERAPAPTNEPGTDLEDTAP
Download sequence
Identical sequences D2S8Q2
WP_012949063.1.76031 gi|284991450|ref|YP_003410004.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]